Custom peptide FOXO4 DRI/foxo4 dri/FOXO4-DRI Peptide Chengdu Youngshe

Quick Details Port: Chengdu Payment Terms: T/T,MoneyGram Supply Ability: 500.0 Gram/Grams per Month Other Names: FOXO4-DRI Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes Grade Standard: Tech Grade Purity: 95% MF: N/A CAS No.: N/A Packaging Detail: plastic/glass bottle protected by bubble film Product Description FOX 04DRI / Senolytics   FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.     FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. New Information P1 Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.   YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.   Since […]