APIBIPP

Loading

  • Sep, Thu, 2020
Plant Extract

Hot Sale Marigold Extract Powder Lutein powder price

Quick Details Port: Shanghai, or according to requirement Payment Terms: L/C,T/T,Western Union,Paypal Supply Ability: 10000.0 Kilogram/Kilograms per Month Form: Powder Sample: Avaliable Extraction Type: Solvent Extraction Product Name: Lutein Grade: Food Grade, Medical Grade Specification: 4%-80% Appearance: Orange Yellow Powder Particle Size: 100% Pass 80 Mesh Type: Herbal Extract Storage: Cool Dry Place Test Method: HPLC UV Packing: 1kg/bag, 25kg/Drum Part: Flower Packaging: DRUM,Plastic Container,Vacuum Packed Shelf Life: 2 Years Proper Storage Variety: Marigold Extract,Marigold Extract Application: Food Supplement, and Medicine Packaging Detail: 1kg/bag or according to your requirements. 25kgs/drum or according to your requirements.      Hot Sale Marigold Extract Powder Lutein powder price     1.Botanical Source: Marigold 2.Part Used: Flower 3.Appearance: Orange Powder 4.Active Ingredient: Lutein 5.Specification: Lutein 4%-90% 6.Test Method: HPLC 7.Molecular Formula: C40H56O2 8.Molecular Weight: 568.85                                  Product Description   Lutein is extracted from fresh flowers of Tagetes Erecta, which is also called Mexican Marigold, African Marigold or Aztec Marigold. Marigold extract lutein powder is liposoluble and it is insoluble in water. Lutein is a xanthophyll and one of natural carotenoids. Lutein is not only a natural coloring agent, but […]

  • Sep, Thu, 2020
Uncategorized

4,4′-Sulphonylbis(2,6-dibromophenol) cas 39635-79-5

Quick Details Port: Shanghai,Ningbo Payment Terms: L/C,D/A,D/P,T/T,Western Union Supply Ability: 100 Ton/Tons per Month Other Names: PHENOL color: white EINECS No.: 254-551-9 Grade Standard: Other Purity: >98% MF: C12H6Br4O4S Application: additive flame retardant Appearance: white powder CAS No.: 39635-79-5 Packaging Detail: 25kg/bag 4,4'-Sulphonylbis(2,6-dibromophenol)CAS NO.39635-79-5M.F:C12H6Br4O4SM.W. 565.85Appearance:White powder Purity:>98% Used for Miscellaneous Chemicals 39635-79-5 4,4'-Sulphonylbis(2,6-dibromophenol) product Name 4,4'-Sulphonylbis(2,6-dibromophenol) Synonyms 254-551-9; PHENOL, 4,4'-SULFONYLBIS(2,6-DIBROMO-; phenol, 4,4'-sulfonylbis[2,6-dibromo-; 4,4'-sulfonylbis(2,6-dibromophenol) Molecular Formula C12H6Br4O4S Molecular Weight 565.8546 InChI InChI=1/C12H6Br4O4S/c13-7-1-5(2-8(14)11(7)17)21(19,20)6-3-9(15)12(18)10(16)4-6/h1-4,17-18H CAS Registry Number 39635-79-5 EINECS 254-551-9 Molecular Structure   Density 2.363g/cm3 Boiling point 539.4°C at 760 mmHg Refractive index 1.716 Flash point 280°C Vapour Pressur 3.02E-12mmHg at 25°C Hazard Symbols   Risk Codes   Safety Description  

  • Sep, Thu, 2020
Plant Extract

ISO echinacea angustifolia extract capsules reglisse echinacea extract powder

Quick Details Payment Terms: L/C,D/P,T/T,paypal Supply Ability: 2000 Kilogram/Kilograms per Week echinacea angustifolia extract Form: Powder Product Name: echinacea extract capsules Extraction Type: Solvent Extraction,Solvent Extraction Active Ingredient: reglisse echinacea extract powder Extract method: Water/Grain Alcohol Grade: AAAAA Assay Method: HPLC Appearance: Fine powder Name: echinacea angustifolia extract capsules reglisse echinacea extract Type: Herbal Extract,echinacea angustifolia extract Part: root Packaging: BOTTLE,DRUM,Plastic Container,Drum,Plastic bag,Drum, aluminum foil bag, plastic bag Variety: Medicinal Morinda Root Extract Certificate: NSF-GMP,BV,KOSHER ISO echinacea angustifolia extract capsules reglisse echinacea extract powder Product Description   echinacea angustifolia extract were used as raw materials to extract Echinacea purpurea from Echinacea purpurea. The main components are phenolic compounds, but also contain a variety of alkyl amines, flavonoids, polysaccharides and a small amount of volatile oil. It has antibacterial, antiviral and immune enhancing functions. It can be used as immunomodulator and immunomodulator. It has antiviral, antifungal, anti-tumor and anti-inflammatory effects. It can stimulate the immune response, strengthen the immune system, prevent influenza, shorten the cold period, assist in the treatment of arthritis or skin diseases, promote wound healing, relieve toothache and burn pain, resist bacterial and viral infections, cancer adjuvant treatment. The echinacea angustifolia extract contains some ingredients. 1. Phenolic compounds […]

  • Sep, Thu, 2020
Daily Chemicals

manufacturer price PSSA POLYSTYRENE SULFONIC ACID 28210-41-5

Quick Details Port: shanghai ,qingdao , dalian , tianjing Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,Paypal Supply Ability: 300000 Kilogram/Kilograms per Month Other Names: POLYSTYRENE SULFONIC ACID Usage: Cosmetic Raw Materials,Detergent Raw Materials,Hair Care Chemicals density: 1.11 g/mL at 25 °C Boiling point: 100°C Purity: 99% Min Appearance: colorless transparent liquid CAS No.: 28210-41-5 EINECS No.: 28210-41-5 solubility: H2O: soluble MF: (C8H8O3S)x refractive index: n20/D 1.3718 Melting point: 1°C Packaging Detail: 200 /drums , as for requirements The details of manufacturer price PSSA POLYSTYRENE SULFONIC ACID 28210-41-5   1. Specification of manufacturer price PSSA POLYSTYRENE SULFONIC ACID 28210-41-5   Items Result Appearance Liquid Content 99.0%min Moisture <0.04% Brand HAIHANG Heavy Metals <0.002%   2. Picture of manufacturer price PSSA POLYSTYRENE SULFONIC ACID 28210-41-5         3. Packing of manufacturer price PSSA POLYSTYRENE SULFONIC ACID 28210-41-5 Packaging :net wt. 200kg/drums, or as per customer request.   4. Application of manufacturer price PSSA POLYSTYRENE SULFONIC ACID 28210-41-5 Nature: Colorless viscous liquid, was fruity, grape fragrant, green incense and white wine aroma. Application :Used in reactive emulsifier, water-soluble polymer, water treatment agent Polyelectrolytes; conductive and antistatic resins for electrical recording and electrophotographic substrates .   5.Shipping way of manufacturer price PSSA POLYSTYRENE SULFONIC ACID 28210-41-5 For small quantity sample or order, […]

  • Sep, Thu, 2020
Pharmaceutical

Custom peptide FOXO4 DRI/foxo4 dri/FOXO4-DRI Peptide Chengdu Youngshe

Quick Details Port: Chengdu Payment Terms: T/T,MoneyGram Supply Ability: 500.0 Gram/Grams per Month Other Names: FOXO4-DRI Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes Grade Standard: Tech Grade Purity: 95% MF: N/A CAS No.: N/A Packaging Detail: plastic/glass bottle protected by bubble film Product Description FOX 04DRI / Senolytics   FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.     FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. New Information P1 Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.   YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.   Since […]

  • Sep, Thu, 2020
Plant Extract

Pure Natural Kava Extract Kavalactone Powder 30%

Quick Details Form: Powder Extraction Type: Solvent Extraction Active Ingredient: Kavalactone Grade: TOP Grade Specification: 30% Shelf life: 24 Months Appearance: fine powder MOQ: 1 Kg Type: Herbal Extract Part Used: root Storage: Dry Place Test Method: HPLC Part: root Packaging: DRUM,Plastic Container,Vacuum Packed Package: 25kg/Paper Drum Variety: Kava Extract,Kava Extract Application: Pharmaceutical Raw Materials Packaging Detail: If small quantity, we packaged it by food-grade plastic bags. If big quantity, we use paper-drum to package it. Selling Units: Single item Single package size: 10X12X11 cm Single gross weight: 1.2 KG Product Description     Basic Information English name Kava Extract,Kavalactones Active ingredients Kavalactones Specification 30%, 70%, 10:1 Appearance Brownish Yellow Powder Test Method HPLC Brief Review of kavalactones 1.kavalactones , also known as Piper methysticum, is a tall shrub in the pepper family that grows in the South Pacific islands. It has been used there for thousands of years as a folk remedy and as a social and ceremonial beverage.The part of the plant used medicinally is the root. Although the root was traditionally chewed or made into a beverage, kava is now available in capsule, tablet, beverage, tea, and liquid extract forms.   2.The main active components in kavalactones […]

  • Sep, Thu, 2020
Organic Intermediate

High quality Mono methyl adipate 627-91-8 from factory

Quick Details Port: China main port Payment Terms: L/C,T/T,Western Union Supply Ability: 5000 Metric Ton/Metric Tons per Year Other Names: MMA Type: Syntheses Material Intermediates form: liquid Color: Colorless Purity: 99% MF: C7H12O4 Appearance: Colorless or transparent liquid Application: intermediate CAS No.: 627-91-8 Packaging Detail: High quality Mono methyl adipate 627-91-8 from factory 200kg/drum High quality Mono methyl adipate 627-91-8 from factory       Detail: 1, Structure formula:HOOC-(CH2)4-COOCH32, Molecular formula:C7H12O4 3, Molecular weight:160 4, CAS No.: [627-91-8] Properties and uses This product is colorless or light pink liquid at room temperature. Boiling point (1.6kpa): 160oC, melting point: 3oC, Relative density:D2041.090.. The product can be solved in organic solvents as alcohol, ether etc., insoluble in water.This product is used as intermediates of medicine and other organic compounds. Quality standard Index name Index Remark Appearance colorless or light pink transparent liquid   Chroma:APHA ≤ 150   Purity:(%) ≥ 97   Melting point: oC 2.5¡«3.5   Content of adipic acid: % ≤ 2   Packing and Shipment 200L plastic drum , Net wt. 200Kg. normal chemicals, Kept in cool and dry place , far away from heat.      

  • Sep, Thu, 2020
Catalyst

Best quality [RuCl(p-cymene)((R)-binap)]Cl CAS 145926-28-9 with steady supply

Quick Details Port: Any port of China Payment Terms: L/C,T/T,Western Union,MoneyGram Supply Ability: 500.0 Kilogram/Kilograms per Month [RuCl(p-cymene)((R)-binap)]Cl CAS 145926-28-9 Other Names: [RuCl(p-cymene)((R)-binap)]Cl EINECS No.: 664-469-9 Classification: Catalyst Purity: 99%min MF: C54H46Cl2P2Ru Application: metal catalyst Appearance: Orange powder CAS No.: 145926-28-9 Packaging Detail: 1g/bag,100g/bag,1kg/foil bag Product description Best quality [RuCl(p-cymene)((R)-binap)]Cl CAS 145926-28-9 with steady supply       Specification Item Specification  Appearance  Orange powder MF C54H46Cl2P2Ru MW 928.87 Assay ≥99.0% Welcome to inquire us to get complete COA of [RuCl(p-cymene)((R)-binap)]Cl CAS 145926-28-9. Our packing Packing of  [RuCl(p-cymene)((R)-binap)]Cl CAS 145926-28-9       Our advantage Unique advantages for [RuCl(p-cymene)((R)-binap)]Cl CAS 145926-28-9 Guaranteed the purity High quality & competitive price Quality control Fast feedback  Prompt shipment Company information Part of Workshops&Laboratory   Our Quality Control System   About us Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wuhan Citywhere is a traffic hinge of China,is a big integrative chemical enterprise being engaged in producing and developing pharmaceutical & its intermediates, food additive  and plant extract, and in distributing the produc ts of our own company and affiliated enterprises.       Our company has professional staff who deal with chemical R&D and scientific management, and holds several sets of analyzing instruments with high efficiency […]

  • Sep, Thu, 2020
Plant Extract

China factory acai berry pulp frozen dried powder for cosmetics skin care

Quick Details Port: Guangzhou Payment Terms: L/C,T/T,Western Union,MoneyGram,pay pal Supply Ability: 100 Ton/Tons per Month Sample orders are available Form: Powder Sample: Free sample is accepted Color: Purple Extraction Type: Liquid-Solid Extraction Active Ingredient: Natural Vitamin C Shelf life: Two Years Grade: Pharmaceutical Grade Appearance: Powder Botanic Name: Euterpe badiocarpa Part Used: Berry Type: Herbal Extract,acai pulp frozen Storage: Dry Area Test Method: HPLC or UV-VIS Part: Berry Packaging: DRUM,Vacuum Packed,catton bottle Variety: Acai Berry Extract Packaging Detail: acai pulp frozen samples in aluminum foil, more than 10kg in cotton. China factory acai berry pulp frozen dried powder for cosmetics skin care   Product Description   Type acai pulp frozen Application Pharmaceutical / Dietary supplement/ Beverage / Cosmetic Specification With the function of antioxidant,anti-radicalization and anti-aging Active Ingredient Natural Vitamin C Proportion extraction 10:1 Botanic Name Euterpe badiocarpa Storage Dry Area Part Used Berry Color Purple Sample Free sample is accepted     [Functions] 1. With the function of antioxidant,anti-radicalization and anti-aging; 2. With the function of treating acute conjunctivitis, bronchitis, gastritis, enteritis and urinary stones; 3. With the function of reducing blood sugar and cholesterol and having the great effect to prevent hypertension; 4. With the function of improving blood circulation […]

  • Sep, Thu, 2020
Pharmaceutical

2019 hot selling products -eria jarensis/n phenethyl dimethylamine/

Quick Details Port: shanghai,china Payment Terms: T/T,Western Union,MoneyGram Supply Ability: 1000 Kilogram/Kilograms per Month 2019 hot selling products -eria jarensis/n phenethyl dimethylami Other Names: new dmaa Usage: Animal Pharmaceuticals Sample: Availiable Grade Standard: Other Color: White Color Powder Product Name: N-phenethyl dimethylamine Purity: 99%min Shelf life: 2 Years Grade: Food Grade, Medicine Grade Appearance: White Powder MOQ: 10gram CAS No.: 1126-71-2 Type: Vitamins, Amino Acids and Coenzymes,Other CAS: 1126-71-2 EINECS No.: / MF: C10H15N Application: Health-care Products Certificate: ISO9001 Packaging Detail: 10kg/drum ,25kg/drum,or as customer demand 2019 hot selling products -eria jarensis/n phenethyl dimethylamine/new dmaa Product Description   Product Name  N-Phenethyl Dimethylamine   Specification  99%-HPLC  Appearance  White powder  MW  –  Package  Aluminum Bag or others  MF  C10H15N  Shelf Life   2 Years  Sample  Avaliable Packaging & Shipping   Company Information   PURE SYNMR INGREDIENTS was registered in 2010 in HK. The predecessor of PURE SYNMR is Shanghai FengYi Biotechnology Co., Ltd, which mainly function as the business and customer service center.   PURE SYNMR doesn't only provide customers with the best quality dietary supplement ingredients, but also research and formulate the novel raw materials that haven't been discovered yet. Besides these, PURE SYNMR offers effective technical supports and professional documentation services to the sports […]

  • Sep, Thu, 2020
Pharmaceutical

M22 Professional Supply TEGO Pep UP Cosmetic Peptide Tetrapeptide-4

Quick Details Port: chengdu Payment Terms: L/C,T/T,Western Union,MoneyGram Supply Ability: 1000.0 Gram/Grams per Month Other Names: Tetrapeptide-4 Usage: Animal Pharmaceuticals Grade Standard: cosmetic grade Sample: polease contact us Color: White Color Product Name: Tetrapeptide-4 Purity: 95%min Storage Duration: 3 years Appearance: White Powder MOQ: 0.1g CAS No.: / Function: Anti-Aging Type: Vitamins, Amino Acids and Coenzymes Storage: Cool Dry Place Packing: Plastic Bottles EINECS No.: / MF: C14H22N4O7 Packaging Detail: Packaged in a transparent plastic bottle, and then wrapped with a bubble film to effectively prevent product ‘s damage. Product Description                                              Recombinant Human Collagen      Name:  Tetrapeptide-4 Alias : TEGO Pep UP Sequence : GEPG Molecular formula: C14H22N4O7 Molecular weight :  358.35 Purity:  95.0% Source:  synthetic MSDS and COA: available       Tetrapeptide-4 acts as an anti-aging, lifting and anti-wrinkle agent. It is a tetrapeptide which increases the collagen production of the skin and the fiber production in the extracellular matrix. This results in reduced wrinkle depth and more defined facial contours as visual effects. Tetrapeptide-4 is suitable for use in anti-aging and other formulations for skin care.     […]

  • Sep, Thu, 2020
Plant Extract

Top standard Ba Ji Tian Bacopin Extract Morinda Officinalis Extract

Quick Details Port: Any port of China Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 888888 Kilogram/Kilograms per Month Bacopin Extract Form: Powder Product Name: Morinda officinalis extract Extraction Type: Solvent Extraction Specification: 4:1-20:1 Shelf life: 2 Years Grade: Medicine Grade & Food grade Appearance: Brown Yellow Powder MOQ: 1kg Particle Size: 100% Pass 80 Mesh Part Used: Root Type: Herbal Extract Storage: Cool Dry Place Test Method: HPLC Part: Root Packaging: DRUM,Plastic Container,Vacuum Packed Variety: Morinda officinalis Extract Certificate: ISO 9001 Packaging Detail: 25kgs packaging Fiber drum outside and plastic bag inside 1-25kgs packaging aluminium bag outside and double plastic bag inside Delivery Detail: within 2 days when get the payment Top quality Bacopin Extract/Morinda officinalis Extract/Morinda Root Extract   Item Specs Product Name  Bacopin Root Extract Botanical Source  Morinda officinalis How Active Ingredient  Polysaccharide, Flavones Specification  5:1 10:1 20:1 Test Method  HPLC            Appearance  Brown Fine Powder                              Part Used  Root Particle size  100% pass 80 mesh Function  Man health protect Morinda is also commonly known as Noni. Morinda is a member of the Rubiaceae family. It can be found in Malaysia and Australia […]

  • Sep, Thu, 2020
Pharmaceutical

Veterinary raw Cephradine l-arginine 99% powder for animal use Cas 38821-53-3

Quick Details Port: Main Chinese Port Payment Terms: L/C,T/T,Western Union,MoneyGram,credit card Supply Ability: 5000.0 Kilogram/Kilograms per Month High Quality 99% Pharm Cephradine l-arginine with lowest price Other Names: Cephradine l-arginine Usage: Animal Pharmaceuticals Grade Standard: Pharma Grade,Medicine Grade Color: white crystalline powder Purity: 99%,98%min Shelf life: 2 Years MOQ: 1 KG Certification: ISO9001 CAS No.: 38821-53-3 Type: Antineoplastic Agents,Urinary System Agents Product name: High Quality 99% Pharm Cephradine l-arginine with lowest price EINECS No.: 254-137-8 MF: C16H19N3O4S Application: Health-care Products Packaging Detail: Cefotaxime Sodium Paper Drum with 2 plastic bags or Aluminium Foiled bag with zip-lock bag.

  • Sep, Thu, 2020
Organic Intermediate

Sodium periodate 7790-28-5

Quick Details Port: Any port in China Payment Terms: L/C,T/T,Western Union,MoneyGram,Secure Payment Other Names: Sodium metaperiodate Form: crystalline powder Grade Standard: Electron Grade, Industrial Grade, Reagent Grade Color: white crystal or white Purity: 99% Density: 3.865 Appearance: – CAS No.: 7790-28-5 NMR: Available Type: Other EINECS No.: 232-197-6 MSDS/TDS: Available Water solubility: 80 g/L (20 °C) MF: NaIO4 Application: used in Electron line etc. HPLC: Available Melting Point: 300 °C Certificate: ISO9001:2008 Packaging Detail: As requested   Product Description    Sodium periodate 7790-28-5          Sodium periodate Product name Sodium periodate Synonyms Sodium metaperiodate CAS No. 7790-28-5 Molecular weight 213.89 Molecular Formula NaIO4 Melting Point 300 ºC (dec.) Appearance white crystal or white crystalline powder Assay 99%min     Packaging & Shipping   PACKING & SHIPING                                                                                                                                Delivery time:In 3-5 days     Shipping methods:By Courier, by air or by sea     Packaging: As requested     Our Services   Why Choose Us?                                                                         1. Quality Our products meet MSDS  safe standard and we have ISO and other certificate so yan can get high quality products from our company. 2. Price We are the company which is the joint of trade and industry so we cao provide the competitive […]

  • Sep, Thu, 2020
Daily Chemicals

Hot Selling High purity raw material BTMS 50 80 25 cas 81646-13-1 for hair conditioner

Quick Details Port: Tianjin Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 3000.0 Ton/Tons per Month Other Names: cosmetic grade btms 50 Usage: Cosmetic Raw Materials,Hair Care Chemicals Purity: 99% Shelf life: 24 Months Specification: BP USP EP Appearance: White Crystalline Powder,white flakes MOQ: 1g CAS No.: 81646-13-1 Storage: Cool and Dry COA: CAS 81646-13-1 Available EINECS No.: 279-791-1 Samples: CAS 81646-13-1 Available MF: C26H57NO4S Package: Aluminium foil bag/Bottle/Drum/Carton Application: pharm intermediate Certificate: ISO/HALAL/GMP Packaging Detail: 1. 25kg/Plastic woven bag, 1000kg/Plastic woven bag; 2. 25kg/plastic barrel, 50kg/ plastic barrel; 3. 50kg/ fiber barrel(can be customized)

  • Sep, Thu, 2020
Pharmaceutical

ISO manufacturer supply skin whitening powder 99% Monobenzone

Quick Details Port: Any port of China Payment Terms: T/T,Western Union Supply Ability: 3000.0 Kilogram/Kilograms per Month Other Names: 4-Benzyloxyphenol Delivery time: 2-3 Days Molecular Weight: 200.23300 Form: Powder Form Product Name: monobenzone Purity: 99 Specification: 98% ~ 99% Shelf life: 2 Years CAS No.: 103-16-2 Type: Auxiliaries and Other Medicinal Chemicals Storage: Cool Dry Place CAS: 103-16-2 EINECS No.: 203-083-3 MF: C13H12O2 Package: Aluminum Foil Bag Molecular Formula: C13H12O2 Packaging Detail: 25kgs packaging Fiber drum outside and plastic bag inside 1-25kgs packaging aluminium bag outside and double plastic bag inside

  • Sep, Thu, 2020
Plant Extract

chinese herb 10:1 Deer root extract powder / rhaponticum carthamoides extract

Quick Details Port: china main port Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 200 Kilogram/Kilograms per Month deer root extract Form: powder Sample: Avaliable Product Name: Organic persimmon leaf extract powder 10:1 Extraction Type: Solvent Extraction Specification: 10:1deer root extract powder Grade: food&pharmaceutical grade Main Ingredient: Flavonoids, steroids Appearance: brown powder MOQ: 1 Kg Particle Size: 90% Pass 80 Mesh Type: Herbal Extract Storage: Cool Dry Place Test Method: HPLC/TLC Part: root Packaging: DRUM,Plastic Container,Vacuum Packed,carton Shelf Life: 2 Years Proper Storage Variety: deer root extract Packaging Detail: deer root extract 1kg~5kg / aluminum foil vacuum bag 25kg/fiber-drums with double plastic bags inside Customized package is also available. Product Description chinese herb 10:1 Deer root extract powder / rhaponticum carthamoides extract     1.deer root extract`s basic information     Product Name:chinese herb 10:1 Deer root extract powder / rhaponticum carthamoides extract plant source:deer root     Particle size:90% pass 80 mesh Main ingredient:Flavonoids, steroids, triterpenoid saponins, phenolic acids, volatile oils and polysaccharides Specification:10:1 Appearance:brown yellow fine powder  Test method:HPLC/UV   2.deer root extract`s function   1)Promote cell growth 2)Lower blood lipids 3)Resistance to atherosclerosis 4)Bacteriostatic 5)Enhance the immune system 6)Regulate stress   3.deer root extract` s application   Applied in […]

  • Sep, Thu, 2020
Food Additives

ISO Factory Inositol Nicotinate, Inositol Hexanicotinate with low price

Quick Details Port: QingDao Payment Terms: D/P,T/T,Western Union,MoneyGram,Trade Assurance Supply Ability: 600 Kilogram/Kilograms per Week Other Names: Inositol Nicotinate Molecular Weight: 810.73 FEMA No.: \ Specification: 99% Appearance: White crystalline powder CAS No.: 6556-11-2 Type: Nutrition Enhancers Test Method: HPLC COA: Available EINECS No.: 229-485-9 MF: C42H30N6O12 Taste: Sweet Melting Point: 254-256°C Packaging Detail: 1.0kgs/Al-foil bag 25.0 kgs/drum or upon customers’ request. ISO Factory Inositol Nicotinate, Inositol Hexanicotinate with low price Introduction   Product Name: Inositol Hexanicotinate CAS No. 6556-11-2 EINECS No. 229-485-9 Molecular Formula: C42H30N6O12 Molecular Weight: 810.73 Specification: 98%min Appearance: White crystal powder Grade: Pharmaceutical    Inositol Hexanicotinate is a niacin formulation that contains no free niacin, but can be hydrolyzed to release free niacin in vivo. Use of inositol niacinate is associated with less flushing than that seen with the use of free niacin. Funtions 1. Can be treat inflammatory bowel disease;2. Clearing away heat and toxic material, dispeling heat from blood to stop bleeding;3. Lowering blood sugar and cholesterin content, losing weight;4. Anti-bacterial, anti-epithyte, calming, and curing sugar diabets. Products Catalog Company Company Information   Flow Chart Certifications Certifications   Buying Guides:   Buying Guides   Packaging Packaging   How to Contact Us?  

  • Sep, Thu, 2020
Organic Intermediate

Pyruvic acid Cas no. 127-17-3

Quick Details Port: Shanghai port Payment Terms: T/T,Western Union, trade assurance Other Names: 2-Ketopropionic Acid Molecular Weight: 88.06 Boiling point: 165 °C(lit.) Color: light yellow clear liquid Purity: 98.5% Density: 1.272 g/mL at 20 °C Appearance: light yellow clear liquid CAS No.: 127-17-3 Assay: 98.5% Type: Agrochemical Intermediates,Flavor & Fragrance Intermediates,pharmaceutical intermediates,Syntheses Material Intermediates CAS: 127-17-3 Product name: Pyruvic acid EINECS No.: C3H4O3 MF: C3H4O3 Flash point: 183 °F Molecular Formula: C3H4O3 Melting point: 11-12 °C(lit.) Packaging Detail: As requested Product Description Product Product name  Pyruvic acid Synonyms  2-Ketopropionic Acid CAS No.  127-17-3 EINECS No.  204-824-3 Molecular formula  C3H4O3 Molecular Weight   88.06 Specifications Appearance  light yellow clear liquid Density    1.272 g/mL at 20 °C Melting point  11-12°C(lit.) Boiling point  165°C(lit.) Flash point  183°F Assay  98.5% Refractive index  n20/D 1.428(lit.) Others Packing  As requested Main Category Why Choose Us Company Information Our Factory   Certifications   Packaging & Shipping   FAQ 1.Q: Do you supply free samples? How can we get samples from you?Usually just for VIP customers by express.2.Q: How do you make a price offer and how long is its validity?By e-mail 15days.3.Q: What payment terms do you accept?L/C, T/T, D/A, DP.West Union,Escrow4.Q: Do you accept third party […]

  • Sep, Thu, 2020
Plant Extract

Pure Natural Oriental Waterplantain Rhizome Extract

Quick Details Port: beijing/shanghai/guangzhou Payment Terms: T/T,Western Union,MoneyGram,pay later Supply Ability: 10 Ton/Tons per Month Type: Herbal Extract Form: Powder Part: Bark Product Name: Alisma extract Extraction Type: Solvent Extraction Packaging: BOTTLE,CAN,DRUM,Glass Container,Plastic Container Grade: a Packaging Detail: Packaging Details 1kg/bag, 25kg/drum, inner by double plastic bag.Or according to the Customers requirements.