APIBIPP

Loading

Tag Health & Medical

  • Sep, Thu, 2020
Pharmaceutical

High purity Pimobendan CAS 74150-27-9 professional engineers competitive price

Quick Details Port: Any port of China Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,TT 100% in advance Supply Ability: 10.0 Kilogram/Kilograms per Month Other Names: Pimobendan Usage: Animal Pharmaceuticals Delivery time: Within 2days Grade Standard: food grade,Medicine Grade Product Name: Pimobendan Purity: 99% Shelf life: 2 Years Appearance: white powder Molecular weight: 334.37 CAS No.: 74150-27-9 Type: Vitamins, Amino Acids and Coenzymes,Pimobendan Payment: TT.Western Union .Credit Card Storage: Cool Dry Place Test Method: HPLC UV COA: Availalbe EINECS No.: 640-420-7 MF: C19H18N4O2 Certificate: ISO FDA COA MSDS Packaging Detail: 25kgs packaging Fiber drum outside and plastic bag inside 1-25kgs packaging aluminium bag outside and double plastic bag inside Delivery Detail: within 2 days when get the payment Shipping : We have Professional shipping agent, based on customers ‘ demand for transport By express :FEDEX,DHL,EMS ,UPS,TNT ect. By SEA and By AIR Product Description High purity Pimobendan CAS 74150-27-9 professional engineers competitive price  Introduction Product Name   Pimobendan  CAS  74150-27-9  Category  API Quality Standard EP/USP MSDS Available COA Contact with Senwayer for updated version COA. Sample Available MOQ 1g,1kg Delivery Date In 3 days Place Of Origin China Application Pharmaceutical raw materials   Function   Strong heart medicine.There are strong positive muscle strength and strong […]

  • Sep, Thu, 2020
Plant Extract

Reference standard 98% Soyasaponin BB HPLC CAS 51330-27-9

Quick Details Port: Shanghai,Tianjin,Beijing,Qingdao Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 800.0 Gram/Grams per Month Form: Powder Extraction Type: Solvent Extraction Product Name: 98% Soyasaponin BB Grade: Reference standard Specification: 98% Soyasaponin BB Appearance: Off-white Powder MOQ: 20mg Type: 98% Soyasaponin BB Test Method: HPLC MS CAS: 51330-27-9 Part: 98% Soyasaponin BB Packaging: BOTTLE Packaging Detail: Packaging: Small brown glass bottle, standard packaging 10mg, 20mg, 50mg; can be packed according to customer needs. Reference standard 98% Soyasaponin BB   Product SKU HS031666 Molecular formula C48H78O18 English Name Soyasaponin BB Molecular Weight 943.134 CAS 51330-27-9 Grade Reference standard HPLC 98% Product Model HPLC>98   Soyasaponin BbSoyasaponin Bb      CAS   51330-27-9          Molecular Weight:943.134        Formula:C48H78O18 Purity:                  HPLC98%   Appearance:     White powderTest Method:    HPLC; Mass;NMR   Usage:                 For laboratory research use only,not for human or diganostic use.   Package              20mg~1g per bottle.Storage:           Store in a well closed container, protected from air and light.Prepare and use solutions at the time of testing. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20℃. Generally, these will be useable for […]

  • Sep, Thu, 2020
Pharmaceutical

Custom peptide FOXO4 DRI/foxo4 dri/FOXO4-DRI Peptide Chengdu Youngshe

Quick Details Port: Chengdu Payment Terms: T/T,MoneyGram Supply Ability: 500.0 Gram/Grams per Month Other Names: FOXO4-DRI Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes Grade Standard: Tech Grade Purity: 95% MF: N/A CAS No.: N/A Packaging Detail: plastic/glass bottle protected by bubble film Product Description FOX 04DRI / Senolytics   FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.     FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. New Information P1 Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.   YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.   Since […]

  • Sep, Thu, 2020
Plant Extract

100% Natural and Organic Bamboo Leaf Extract powder bamboo leaf Flavonoid

Quick Details Form: Powder Sample: 10-20g Solubility: Good water-solubility Product Name: bamboo leaf extract Extraction Type: Solvent Extraction Active Ingredient: bamboo leaf Flavonoid Latin Name: Caulis Bambusae in Taenia Shelf life: 2 Years Specification: 40% Grade: Food grade Appearance: Brown Yellow Powder MOQ: 1KG Type: Herbal Extract Test Method: HPLC Part: Leaf Packaging: BOTTLE,DRUM,Plastic Container Variety: herbal extract Packaging Detail: Sealed export grade drums & double of sealed plastic bag. Small package as costumer’s requirement Selling Units: Single item Single package size: 20X15X10 cm Single gross weight: 1.5 KG

  • Sep, Thu, 2020
Pharmaceutical

Magnesium gluconate cas 3632-91-5

Quick Details Port: Shanghai Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 1000 Tonne/Tonnes per Year Other Names: Magnesium Gluconate Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes EINECS No.: 222-848-2 Grade Standard: cosmetic grade,Feed Grade,food grade,Medicine Grade Purity: 99% MF: C12H22MgO14,C12H22MgO14 Appearance: White Crystalline Powder CAS No.: 3632 -91-5 Packaging Detail: 25kg/drum, two plastic bags inside Magnesium gluconate cas 3632-91-5 Specifications CAS No.:3632-91-5 Other Names:magnesium D-gluconate hydrate MF:C12H22MgO14 EINECS No.:222-848-2 Place of Origin: Anhui, China (Mainland) Type:Nutrition Enhancers, Stabilizers Brand Name:Joye Model Number:food grade   Specification: Magnesium Gluconate  CAS No: 3632-91-5  EINECS No: 222-848-2  Molecular formula: C12H22MgO14  Molecuar weight: 414.5997 Magnesium Gluconate Chemical name:Magnesium Gluconate Molecular formula:C12H22MgeO14.2H2O dihydrate  Molecular weight:450.63 dihydrate  CAS NO.:59625-89-7 dihydrate  Standard :USP/FCC Characters:white fine powder or granule and soluble in water.  Performance and use: mainly used as nutriment and diet additive (1) play an important role for maintaining nerve impulse drive and nerve muscle sensitivity..  (2) good magnesian food hardening agent. Packing:Paperboard drum, full paper drum and brown paper bag lined with PE plastic bag. Net weight is 25KG Storage:Store in dry, ventilated and clean environments in room temperature. Transportation:non-hazardous product and transport by general chemical products.   Item Index USP   Content 98.0%-102.0% Magnesium content:5.06%-5.86%(calculated from […]

  • Sep, Thu, 2020
Pharmaceutical

Monobenzone Powder For Monobenzone Cream/4-Benzyloxyphenol

Quick Details Port: Tianjin/Shanghai/Ningbo/Dalian Payment Terms: L/C,T/T,Western Union,Paypal Supply Ability: 1000 Kilogram/Kilograms per Week Grade Standard: cosmetic grade Purity: 99% MW: 308.37 main function: Skin Whitening sample: 10g free for test MOQ: 1KG CAS No.: 103-16-2 Type: Skin Whitening appearance: White crystal powder shelf life: 24 months EINECS No.: 203-083-3 MF: C20H20O3 mesh: 100% pass 80 mesh Delivery Detail: within 3 working days after payment,according to quantity Packaging Detail: 1kg with double plastic container inside/Aluminum foil bag outside 25 kg with double plastic container inside/fiber drum outside N.W: 25kgs. I.D. 35 x H51 cm Monobenzone Powder For Monobenzone Cream/4-Benzyloxyphenol   Welcome to Realin Basic Information Product Name: Monobenzone  Appearance : Off-Wthite Powder  CAS: 103-16-2  Molecular formula: C20H20O3  Molecular weight : 308.371  Supplier name:           Xi'an Realin Synonyms: (Benzyloxy)phenol; p-Hydroxyphenyl benzyl ether; 4-(Phenylmethoxy)phenol; Agerite alba; Benoquin; Benzoquin; Benzyl hydroquinone; Depigman; Hydroquinone benzyl ether; Monobenzone; Monobenzyl hydroquinone; PBP; Pigmex; 4-benzyloxy phenol (Monobenzone); 4-benzyloxy phenol; 4-(benzyloxy)phenol; 4-Benzyloxyphenol; PHENOL,4-(PHENYLMETHOXY)-  Specification 99.5% Main Function 1.Monobenzone is the monobenzyl ether of hydroquinone. Monobenzone occurs as a white, almost tasteless crystalline powder, soluble in alcohol and practically insoluble in water.  2.Monobenzone is a compound used as a topical drug for medical depigmentation. The topical application of monobenzone in animals decreases the excretion of melanin from melanocytes.The same action is thought to be responsible for the depigmenting effect of the drug in humans. Monobenzone may cause destruction of melanocytes thus, bringing about permanent dipigmentation in vitiligo patients. 3.Monobenzone is the monobenzyl ether of hydroquinone. Monobenzone powder can be compounded to make a depigmenting cream.  It is used to whiten patchy skin and create and even skin tone that is pale and smooth. 4.Monobenzone USP, is a strong depigmentation agent, used to treat the patients suffering from vitiligo. **********************************************************************************************  Entity Shooting/Picture Show   Why Realin 1.100% Pure Nature Raw Material, Selecting excellent planting base 2.Our factory self-produced, the quality can be strictly controlled 3.Quick delivery, firm package,stocks supply 4.Professional sales team, Providing any feedback from the customers 5.Regarding customer benefit as the starting point, pay attention to the real needs of the customer Delivery/Payment Terms and Package 1.Delivery:   By UPS/DHL/TNT/EMS or by Air/ Sea as per Qty.2.Samples:   Within 48 Hours.                                                Payment: Paypal,Western Union and T/T Method: Using Western Union and Paypal when the amount is less than US$5000.   Package  1) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two  […]

  • Sep, Thu, 2020
Plant Extract

Pure Organic 20% 25% Olive Leaf Extract Powder 40% 98% Oleuropein

Quick Details Port: Tianjin Shanghai Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,Paypal, Ali Trade Assurance Supply Ability: 2000.0 Kilogram/Kilograms per Month Form: Powder Sample: 10-20g Extraction Type: Solvent Extraction Product Name: Pure Organic 20% 25% Olive Leaf Extract Powder 40% 98% Oleuropein Active Ingredient: Oleuropein Grade: Medcine Specification: 20% 25% 40% 98% Appearance: Brown powder MOQ: 1kg Type: Herbal Extract Part Used: Fruit Test Method: HPLC Packing: 1kg/foil bag, 25kg/drum Part: Leaf Packaging: DRUM,Mason Jar,Plastic Container,Vacuum Packed,Plastic Bag, Foil Bag Shelf Life: 2 Years Proper Storage Variety: Olive Leaf Extract Packaging Detail: 1kg with double P.E. bag in per foil bag, 25kg / drum. Or according to your requirements.

  • Sep, Thu, 2020
Plant Extract

Rauwolfia Serpentina Extract Reserpine 98% CAS No. 50-55-5

Quick Details Port: China Main Port Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 500.0 Kilogram/Kilograms per Month Mesh: 100% pass 80 mesh Form: Powder Extraction Type: Solvent Extraction Product Name: Reserpine Purity: 98% Grade: Pharmaceutical grade,Pharmaceutical grade Type: Herbal Extract Part: Root Packaging: DRUM,Plastic Container Extraction Type: Solvent Extraction Variety: Reserpine Appearance: White or light yellow powder Packaging Detail: 1: 1-5 kg/bag (1 kg net weight, 1.2 kg gross weight; Packed in an aluminum foil bag) ; 2: 25 kg /drum (25 kg net weight,28 kg gross weight; Packed in a cardboard-drum with two plastic-bags inside) ; 3: as per your request. Company head     Product Description Rauwolfia Serpentina Extract Reserpine 98% CAS No. 50-55-5 —————————————————————————————————————————————-  Specification:   Product Name Reserpine Source Rauvolfia verticillata(Lour.)Baill. Appearance White or light yellow powder Purity 98% Test Method HPLC       Product Image:   ————————————————————————————————————————————————- Main Function: Reserpine can lower blood pressure and slow down heart rate. The effect is slow, mild and lasting. It has a lasting stabilizing effect on the central nervous system and is a good sedative. In the treatment of hypertensive patients, it can strengthen the effect of lowering blood pressure when used in combination with topical Chinese medicines such […]

  • Sep, Thu, 2020
Pharmaceutical

Factory supply 99% Purity Melatonin bulk powder

Quick Details Port: Any port in china Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,Paypal, Trade Assure Supply Ability: 5000.0 Kilogram/Kilograms per Month Other Names: Melatonin Usage: Animal Pharmaceuticals Molecular Weight: 232.27 Grade Standard: Medicine Grade Sample: 10-20g Boiling point: 512.8°C at 760 mmHg Product Name: Melatonin Purity: 99% Shelf life: 2 Years Appearance: White Powder CAS No.: 73-31-4 Assay: 99% Type: Antibiotic and Antimicrobial Agents,Vitamins, Amino Acids and Coenzymes,Central Nervous System Agents Storage: Cool Dry Place COA: Availale EINECS No.: 203-632-7 MF: 13N2H16O2 Package: 1kg/bag 25kg/drum Packaging Detail: 1KG/Aluminum foil bag, carton outside; 25KG/Fiber drum, double plastic-bag inside; Or as your customs requirements.

  • Sep, Thu, 2020
Plant Extract

ISO echinacea angustifolia extract capsules reglisse echinacea extract powder

Quick Details Payment Terms: L/C,D/P,T/T,paypal Supply Ability: 2000 Kilogram/Kilograms per Week echinacea angustifolia extract Form: Powder Product Name: echinacea extract capsules Extraction Type: Solvent Extraction,Solvent Extraction Active Ingredient: reglisse echinacea extract powder Extract method: Water/Grain Alcohol Grade: AAAAA Assay Method: HPLC Appearance: Fine powder Name: echinacea angustifolia extract capsules reglisse echinacea extract Type: Herbal Extract,echinacea angustifolia extract Part: root Packaging: BOTTLE,DRUM,Plastic Container,Drum,Plastic bag,Drum, aluminum foil bag, plastic bag Variety: Medicinal Morinda Root Extract Certificate: NSF-GMP,BV,KOSHER ISO echinacea angustifolia extract capsules reglisse echinacea extract powder Product Description   echinacea angustifolia extract were used as raw materials to extract Echinacea purpurea from Echinacea purpurea. The main components are phenolic compounds, but also contain a variety of alkyl amines, flavonoids, polysaccharides and a small amount of volatile oil. It has antibacterial, antiviral and immune enhancing functions. It can be used as immunomodulator and immunomodulator. It has antiviral, antifungal, anti-tumor and anti-inflammatory effects. It can stimulate the immune response, strengthen the immune system, prevent influenza, shorten the cold period, assist in the treatment of arthritis or skin diseases, promote wound healing, relieve toothache and burn pain, resist bacterial and viral infections, cancer adjuvant treatment. The echinacea angustifolia extract contains some ingredients. 1. Phenolic compounds […]

  • Sep, Thu, 2020
Herbal Medicine

High quality Herbal medicine Rhizoma Coptidis cortex Huang lian with best price

Quick Details Port: Chinese Main Ports Payment Terms: L/C,T/T,Western Union Supply Ability: 50000 Kilogram/Kilograms per Year Function: Heat-Clearing & Detoxifying Drugs Type: Crude Medicine Product name: Rhizoma Coptidis cortex Chinese name: Huang lian Packaging Detail: Bag/Box/Carton/Drum Type: Crude Medicine Part used:Rhizome Place of Origin:Sichuan,China Brand Name: Chinese Medicine Model Number:Natural Herbs Chinese Name:Huang Lian English Name: Coptidis Rhizoma Latin Name:Coptis chinensis Franch Specification:Dried herb Size:Customized Brand: Drotrong Packing: Customized Source:Artificial cultivation Part used:Rhizome Water content:14.0% Total ash:≤5.0% Extract:≥15.0% Berberine: ≥5.5% Berberine: ≥0.80% Coptisine ≥ 1.6% Palmatine: ≥7.0% Introduction: The rhizome of perennial herb-Coptis chinensis Franch or C. deltoidea C. Y. Cheng et Hsiao or C. teeta Wall. of family Ranumculaceae.Mainly in Sichuan, Hubei provinces of China. C. deltoidea C. Y. Cheng et Hsiao is mainly from Hongya, Emei in Sichuan province of China, C. teeta Wall is mainly from Yunnan province of China.Collected in autumn.Slight smell, extremly bitter. Main function 1.Clearing away heat and eliminating dampness.    2.Purging intense heat and detoxify.

  • Sep, Thu, 2020
Pharmaceutical

Good Price Top Quality Powder Zolmitriptan 139264-17-8

Quick Details Port: Beijing, Shanghai, Shenzhen Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 50 Kilogram/Kilograms per Month Other Names: NA Grade Standard: Medicine Grade,Tech Grade Characteristic: White to off-white powder Product Name: Zolmitriptan Purity: 99%min Grade: Phamaceutical Grade Residue on ignition: ≤0.1% Shelf life: 2 Years MW: 287.36 CAS No.: 139264-17-8 Assay: ≥99.0% Type: Antimigraine COA: avaliable Production Capacity: 50kg/month Heavy Metals: 10ppm EINECS No.: NA MF: C16H21N3O2 Packaging Detail: Bulk qty: 25kg/drum, inside two level plastic bags Small qty: Aluminium bag, inside two level plastic bags Others: can do your package or split small packages according to your request Good Price/Top Quality 99.0%, API Powder Zolmitriptan CAS#139264-17-8       WHY CHOOSE US?     1. Strong backup of facotry: high R&D ability, favorable quality and competitive price 2. Stock avaliability 3. Flexible business way, like payment term and product delivery 4. Fast response 24*7 5. A good troubleshooter/very positive attitude for after service   PRODUCT DESCRIPTION   Prodcut name Zolmitriptan Synonyms (4R)-4-[[3-(2-Dimethylaminoethyl)-1H-indol-5-yl]methyl]oxazolidin-2-one MOQ 1G CAS No. 139264-17-8 Appearance White or off- white crystalline powder Molecular Formula C16H21N3O2 Molecular Weight 287.36 Assay 99% Application Pharma grade or research purpose Packing As per your request Storage Preserve in tight,light-resistant containers in a cool […]

  • Sep, Thu, 2020
Pharmaceutical

GK health Professional amiodarone 19774-82-4 made in China

Quick Details Port: any port in China Payment Terms: L/C,D/P,Western Union,MoneyGram Supply Ability: 10.0 Ton/Tons per Month (Capactity 100tons/year) Other Names: amiodarone Usage: Animal Pharmaceuticals Ethanol: NMT5000ppm Grade Standard: Medicine Grade Impurity H (by TLC): NMT 0.02% Purity: 99% up MW: 681.77 EINECS: 243-293-2 Appearance: white crystalline powder CAS No.: 19774-82-4 Assay: 98.5%~101.0% Type: anti-arrhythmic CAS: 19774-82-4 EINECS No.: 243-293-2 pH: 3.2~3.8 MF: C25H29I2NO3.ClH, C25H29I2NO3.ClH Melting Range: 159~163°C Packaging Detail: 1. 1 kilogram per Aluminum Foil Bag with one plastic-bags inside; 2. 25 kilograms per cardboard barrel with one plastic-bags inside; 3. Packaging as the customers’ requirements. Product Information       Introduction:   CAS No. 19774-82-4 Other Names amiodarone MF C25H29I2NO3.ClH, C25H29I2NO3.ClH EINECS No. 243-293-2 Place of Origin China/shaanxi Type anti-arrhythmic Grade Standard Medicine Grade Brand Name GK health Model Number GK heaalth Purity 99% up Appearance white crystalline powder CAS 19774-82-4 MW 681.77 EINECS 243-293-2 Melting Range 159~163°C pH 3.2~3.8 Impurity H (by TLC) NMT 0.02% Ethanol NMT5000ppm Assay 98.5%~101.0%   Product Display      How to start orders or make payments? A:You can send our your Purchase order(if your company has), or just  send a simple confirmation by email or by Trade Manager, and we will send […]

  • Sep, Thu, 2020
Pharmaceutical

China supply Glucosamine Sulfate powder price CAS 29031-19-4

Quick Details Port: China port Payment Terms: L/C,T/T,Western Union,MoneyGram, Assurance order Supply Ability: 10000 Kilogram/Kilograms per Month China supply Glucosamine Sulfate powder price CAS 29031-19-4 Other Names: Glucosamine Usage: Animal Pharmaceuticals,Active Pharmaceutical Ingredient Sample: Glucosamine Sulfate Avaliable Grade Standard: Medicine Grade Product Name: Glucosamine Sulfate powder Active Ingredient: Glucosamine Sulfate Purity: 99% Appearance: White or white crystalline powder MOQ: 1KG CAS No.: 29031-19-4 Type: Auxiliaries and Other Medicinal Chemicals Storage: Cool Dry Place EINECS No.: N/A MF: (C6H14NO5)2SO4 Shelf Life: 2 years Application: Pharmaceutical Raw Intermediates Certificate: ISO 9001 Packaging Detail: 1kg per Foil Bag, 10 Bags per carton. 25 kg per Drum. Or Customized Package. China supply Glucosamine Sulfate powder price CAS 29031-19-4

  • Sep, Thu, 2020
Plant Extract

Pure Natural Oriental Waterplantain Rhizome Extract

Quick Details Port: beijing/shanghai/guangzhou Payment Terms: T/T,Western Union,MoneyGram,pay later Supply Ability: 10 Ton/Tons per Month Type: Herbal Extract Form: Powder Part: Bark Product Name: Alisma extract Extraction Type: Solvent Extraction Packaging: BOTTLE,CAN,DRUM,Glass Container,Plastic Container Grade: a Packaging Detail: Packaging Details 1kg/bag, 25kg/drum, inner by double plastic bag.Or according to the Customers requirements.

  • Sep, Thu, 2020
Pharmaceutical

Pharmaceutical ingredient Iohexol powder CAS 66108-95-0

Quick Details Port: Shanghai or Hangzhou or Beijing etc Payment Terms: L/C,T/T,Western Union,PayPal Supply Ability: 1000.0 Kilogram/Kilograms per Month Other Names: Iohexol Usage: Animal Pharmaceuticals Grade Standard: Medicine Grade Purity: 99%min MOQ: According to regular packing CAS No.: 66108-95-0 Type: Auxiliaries and Other Medicinal Chemicals EINECS No.: 266-164-2 price: Negotiable & depends on quantity MF: C19H26I3N3O9 COA&Document: Please send us inquiry Packaging Detail: According to regular packing.   For more about us , please visit our site: https://afinechem.en..com or https://afinepharm.en..com/   Iohexol   CAS 66108-95-0    Appearance: white powder Molecular Weight: 821.14 Density: 2.2 g/cm3 Boiling Point: 891.5 °C at 760 mmHg Melting Point: 254-2560C Flash Point: 493 °C Storage Temperature: ?20°C Refractive index: 1.724  Solubility: Freely soluble Stability: Stable at normal temperatures and pressures. Usage: Imaging agent        

  • Sep, Thu, 2020
Plant Extract

Hot Sale Marigold Extract Powder Lutein powder price

Quick Details Port: Shanghai, or according to requirement Payment Terms: L/C,T/T,Western Union,Paypal Supply Ability: 10000.0 Kilogram/Kilograms per Month Form: Powder Sample: Avaliable Extraction Type: Solvent Extraction Product Name: Lutein Grade: Food Grade, Medical Grade Specification: 4%-80% Appearance: Orange Yellow Powder Particle Size: 100% Pass 80 Mesh Type: Herbal Extract Storage: Cool Dry Place Test Method: HPLC UV Packing: 1kg/bag, 25kg/Drum Part: Flower Packaging: DRUM,Plastic Container,Vacuum Packed Shelf Life: 2 Years Proper Storage Variety: Marigold Extract,Marigold Extract Application: Food Supplement, and Medicine Packaging Detail: 1kg/bag or according to your requirements. 25kgs/drum or according to your requirements.      Hot Sale Marigold Extract Powder Lutein powder price     1.Botanical Source: Marigold 2.Part Used: Flower 3.Appearance: Orange Powder 4.Active Ingredient: Lutein 5.Specification: Lutein 4%-90% 6.Test Method: HPLC 7.Molecular Formula: C40H56O2 8.Molecular Weight: 568.85                                  Product Description   Lutein is extracted from fresh flowers of Tagetes Erecta, which is also called Mexican Marigold, African Marigold or Aztec Marigold. Marigold extract lutein powder is liposoluble and it is insoluble in water. Lutein is a xanthophyll and one of natural carotenoids. Lutein is not only a natural coloring agent, but […]

  • Sep, Thu, 2020
Pharmaceutical

GMP Factory supply good quality Penicillin G Sodium salt/benzylpenicillin sodium powder

Quick Details Port: Shanghai,Guangzhou,Qingdao etc Payment Terms: L/C,D/P,T/T,Western Union,MoneyGram,paypal Supply Ability: 20000.0 Kilogram/Kilograms per Month Other Names: Penicillin G Sodium Salt Usage: Animal Pharmaceuticals Form: Power Grade Standard: Feed Grade,Medicine Grade Sample: Available Purity: 99%min Shelf life: 2 years Standard: USP BP FCC CP GB EP Appearance: White Powder MOQ: 1kg CAS No.: 69-57-8 Assay: 99.0~101.0% Type: Antibiotic and Antimicrobial Agents EINECS No.: 200-710-2 Other Name: Penicillin G Sodium Salt Water solubility: Slightly soluble in water MF: C16H17N2NaO4S Certificate: GMP/ISO9001 Packaging Detail: 1kg with double plastic container inside/Aluminum foil bag outside. >25kg with double plastic container inside/Fiber drum outside. >Or it is at your option. Advantages Free sample for test 100% guaranteeing customs pass,200% supporting re-sending policy, best quality, reasonable price, safe & fast shipping. Product Description   Name: Penicillin G Sodium salt Synonyms: Sodium benzylpenicillin; Sodium penicillin C.A.S NO. : 69-57-8 Standard: EP/BP/USP Molecular formula: C16H17N2NaO4S Molecular weight: 356.37 Characteristic: White crystalline powder Melting point: 209-212°C Boiling point: 663.3°C at 760 mmHg       Penicillin G potassium is a white crystalline powder, odorless or slightly specific odor, moisture absorption. Soluble in water, physiological saline, glucose solution.  Penicillin G Potassium is Suitable for infections caused by sensitive bacteria, such as abscesses, bacteremia, […]

  • Sep, Thu, 2020
Pharmaceutical

Y-320 pharmaceutical material 288250-47-5

Quick Details Port: shanghai Payment Terms: L/C,D/A,D/P,T/T,Western Union Supply Ability: 100 Gram/Grams per Month Other Names: Y320 Exact Mass: 504.204 Molecular Weight: 505.011 Pathway: Immunology/Inflammation Grade Standard: Tech Grade Solubility: DMSO : 5.5 mg/mL (10.89 mM) LogP: 4.33498 Purity: 98% min CAS No.: 288250-47-5 Target: Interleukin Related Type: Auxiliaries and Other Medicinal Chemicals EINECS No.: N/M MF: C27H29ClN6O2 PSA: 86.42 Packaging Detail: Packaging according to customer requirements.

  • Sep, Thu, 2020
Pharmaceutical

Hot selling Nootropics powder / Carphedon CAS 77472-70-9

Quick Details Port: Any port in China Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 1000 Kilogram/Kilograms per Month Other Names: Phenylpiracetam Usage: Animal Pharmaceuticals Grade Standard: cosmetic grade,Medicine Grade Purity: 99% Standard: In house,USP,JP,EP,BP Dosage Form: Powder Specification: 99% Appearance: powder CAS No.: 77472-70-9 Type: Vitamins Test Method: HPLC/UV EINECS No.: 77472-70-9 MF: C12H14N2O2, C12H14N2O2 Packaging Detail: 0.5kgs/Al-foil bag or according to your requirement    High Purity Nootropics 98% Phenylpiracetam Powder  Specification Product name:PhenylpiracetamOther Name:4-phenyl-2-pyrrolidone-1-acetamideSynonyms:2-(2-Oxo-4-phenylpyrrolidin-1-yl)acetamideCAS Number:77472-70-9MF:C12H14N2O2MW:218.25 Phenylpiracetam is a nootropic drug derived from piracetam, and is more potent (i.e. lower dosage is used). It belongs to the racetam family of nootropics. Phenylpiracetam was developed based on Piracetam, and is 8-30 times stronger than Piracetam     ITEMS SPECIFICATION RESULTS BP2010 /EP6 Appearance crystalline powder Conforms Melting point About 205°C 206.4°C~206.7°C Identification Meet the requirements Conforms Appearance of solution Clear, not more intense than Y7 Conforms PH 2.4~3.0 2.60 Loss on drying ≤0.5% 0.04% Sulphated ash ≤0.1% 0.01% Heavy metals ≤20 ppm <20 ppm Related substances ≤0.25% Conforms Assay 99.0%~101.0% 99.8% USP32 Identification Meet the requirements Conforms Loss on drying ≤0.5% 0.04% Residue on ignition ≤0.1% 0.01% Heavy metals ≤0.003% <0.003% Residue solvent – Ethanol ≤0.5% <0.04% Chloride 16.9%~17.6% 17.1% Assay 98.0%~102.0% 100.0% Conclusion: The product […]